PTM Viewer PTM Viewer

AT1G03055.1

Arabidopsis thaliana [ath]

beta-carotene isomerase D27-like protein

No PTMs currently found

PLAZA: AT1G03055
Gene Family: HOM05D001695
Other Names: AtD27,A. thaliana homolog of rice D27; DWARF27

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 264

MNTKLSLSQTKIFTFTTWFNDTRSGLDRRSSISPTLCSKPVYSGKLKAAKETARIETSNTKNASIEDSFFSKIAINYLSKNLQDAAGISSSSKSTDYDRLVDTATRVSRNFDTKQQHEFVLSSLDRALPTVISSLIKMAFPPSKVSRELFALFTTISFAWLVGPSEVRETEVNGRKEKSVVYIEKCRFLEQSNCVGMCTHICKIPSQIFIKNSLGMPIYMEPDFNDLSCKMMFGREPPEIEDDPAMKQPCFEFCKSNKSYGVKH

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR025114 160 241
Molecule Processing
Show Type From To
Transit Peptide 1 47

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here